SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|87552|fgenesh1_pm.2_#_323 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|87552|fgenesh1_pm.2_#_323
Domain Number 1 Region: 279-534
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.61e-105
Family Hsp90 middle domain 0.00000000504
Further Details:      
 
Domain Number 2 Region: 3-210
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-74
Family Heat shock protein 90, HSP90, N-terminal domain 0.0000000549
Further Details:      
 
Domain Number 3 Region: 557-679
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 5.75e-38
Family HSP90 C-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|87552|fgenesh1_pm.2_#_323
Sequence length 714
Sequence
MATESFGFQAEISQLLDLIINTFYSNKEIFLRELISNGSDALDKIRYASLTDPTVLDTEK
DLYIRITPDKENKLLSIRDTGIGMTKADLVNNLGTIAKSGTKGFMEALSSGADISMIGQF
GVGFYSAYLVAERVQVISKHNDDEQYIWESAAGGTFTITPDTVNPSLGRGTELRLYLKED
QLEYLEEKKIKDIVKKHSEFISYPIQLAVTKEVEKVRERYLNTRPTLIGLQEVEDDEAEE
EKDEKEESKIEEVEDEDDKPKKKTKKVKEIETTNEELNKTKPIWTRNPSDITAEEYSAFY
KSLTNDWEDHLAVKHFSVEGQLEFKAILFVPKRAPFDLFETKKKRNNIKLYVRRVFIMDD
CEDLIPEYLNFVKGIVDSEDLPLNISRETLQQNKILKVIRKNIVKKCMDVFSEIAEDKDN
FSKFYESFGKNLKLGIHEDAQNRSKLAEFLRFFSTKSLDEQTSLKDYITRMPEVQKSIYF
LTGESLAAVKDSPFLEVLKRKGFEVLLLVDPIDEYAITQLKEFEGKKLVCVSKEGLELEE
SEDEKKAREEEASQFNDLCTTIKDALGDKVEKVVVSNRITDSPCVLVTGQFGWSSNMERI
MKAQALRDSSMSSYMASKKTLELNPKNPIVKELKRKVAEDKADKSVRDLTYLLFETALLT
SGFSLEDPTSFAKRINRMISLGLDVDEEEEAPVASSDAPAASEGASTSAMEEID
Download sequence
Identical sequences XP_007764667.1.51617 jgi|Conpu1|87552|fgenesh1_pm.2_#_323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]