SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|97640|estExt_Genewise1.C_2_t20353 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|97640|estExt_Genewise1.C_2_t20353
Domain Number 1 Region: 4-67
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000327
Family AN1-like Zinc finger 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|97640|estExt_Genewise1.C_2_t20353
Sequence length 76
Sequence
MAPKKRCQLQNETPCNSAALRIVGQCPHCRAEFCGTHRLPEHHNCNKLEDCRQQAYERNK
AKLESERTVASKMTTV
Download sequence
Identical sequences jgi|Conpu1|97640|estExt_Genewise1.C_2_t20353 XP_007764658.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]