SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicsq1|132917|fgenesh1_kg.3_#_405_#_isotig00027 from Dichomitus squalens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicsq1|132917|fgenesh1_kg.3_#_405_#_isotig00027
Domain Number 1 Region: 172-391
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.97e-89
Family ATP sulfurylase catalytic domain 0.0000000157
Further Details:      
 
Domain Number 2 Region: 4-171
Classification Level Classification E-value
Superfamily PUA domain-like 5.66e-56
Family ATP sulfurylase N-terminal domain 0.000000893
Further Details:      
 
Domain Number 3 Region: 392-507,544-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.55e-27
Family ATP sulfurylase C-terminal domain 0.0000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicsq1|132917|fgenesh1_kg.3_#_405_#_isotig00027
Sequence length 575
Sequence
MANTPHGGVLKDLVARDEHLRDNLKAEAHTIPDIVLTERQLCDLELIINGGFSPLEGFMN
EADYKNVVDSLRLADGTLFPMPITLDVSREDIDRLSLAPGKRIALRDPRDDEALAIITVD
DVYRPDQVKEAIQVFGADDPAHPSVAYLRNKVNEYYVGGKVQVIQPPTHFDYVALRYTPA
ELRAHFKKLAWRKVVAFQTRNPMHRAHRELTVRAARQRQANVLIHPVVGLTKPGDVDHYT
RVRVYEAIMAKYPNGMGHLALLPLAMRMAGPREAVWHAIIRKNFGATHFIVGRDHAGPGK
NSQGQDFYGPYDAQDLVMKYHEELQIEMVPFQQMTYLPSTDEYQPVDEVPKGVQTLDISG
TELRRRLKTGAPIPDWFSYDAVVKTLRESYPPRLKQGFVVFLTGLHNSGKDTIAKALQVI
LNQQGGRSVSLLLGDTIRPELDTPFSATPEERSKNLQRLSFVAAELARAGAAVILAPTVH
TQAARDAIKSTILSQAGSGANFFAINVATPLEHCEANDRKGIYTRARAGEISGVPGVDEA
FEPFERPQLTVDVTKQNIPEIVHSVVLLLETESLL
Download sequence
Identical sequences jgi|Dicsq1|132917|fgenesh1_kg.3_#_405_#_isotig00027 XP_007361965.1.3125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]