SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dicsq1|143991|fgenesh1_pm.3_#_280 from Dichomitus squalens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dicsq1|143991|fgenesh1_pm.3_#_280
Domain Number 1 Region: 4-372
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.09e-95
Family IF2B-like 0.000000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dicsq1|143991|fgenesh1_pm.3_#_280
Sequence length 386
Sequence
MPALTSIRTSEGKLEIVNQLLLPHTTEFIEIKTIDDAFDAIKSMKIRGAPAIASLAALAV
ANHLSNALKASPTPPCLETTEVLKQHVSELLAHLFTARPTAVNLGAATRRLSKKLQKEID
ADKDTRTIAQELIAEAKQIDAEDVGRNKLMSKWGGDWLVERVESQGGSGADLNVMTVCNT
GSLATSGYGTALGLITYLHETGKLQRAFFTQSTPYHQGSRLTAFELQSLKIPSTMLCDSM
VGSLFQHHHIHAIAVGADRIARNGDTANKIGTYNAAVLAARHNIPFIVVAPVSTVDLEVA
DGSGIPIEHRPAIEACLVRGALYPPKLDAQGVKEQATVMVTPEGLEGVYNPSFDVTPASL
ITAIVTEKGVAVKKSGKEAFDLTPIV
Download sequence
Identical sequences jgi|Dicsq1|143991|fgenesh1_pm.3_#_280 XP_007361971.1.3125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]