SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|172765|estExt_Genewise1Plus.C_5_t30434 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dotse1|172765|estExt_Genewise1Plus.C_5_t30434
Domain Number 1 Region: 18-106,188-343
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.91e-19
Family C-terminal domain of adrenodoxin reductase-like 0.075
Further Details:      
 
Weak hits

Sequence:  jgi|Dotse1|172765|estExt_Genewise1Plus.C_5_t30434
Domain Number - Region: 295-331,378-445
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0945
Family Formate/glycerate dehydrogenases, NAD-domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|172765|estExt_Genewise1Plus.C_5_t30434
Sequence length 550
Sequence
MPSSRVDTLSSTREHTLPFVYDVLIVGAGPCGLAVAARLREQTPSALFTDEEHHRYHWIN
KHGGYAWISSPKTENQRRSQRSASEPSILVLDSSGDGWMAKWKRLFSQLEISHLRSPMFF
HPDPHDRDGLLAYAHSQGRNCECLEITGCVGKELSKHQMKKKKKRSSRNDGEQAKPPVTI
DERDRKDYFTPPSDLFQNYCDFIAKRYDLLDTNLIQKAAVDEIDYDLVPRLSAEKKLFTI
RAEEQTYFAQSVVLAVGAGNPPSIPRPFPQSGCACACHAFTGQDEGLSARLTAGRPTNVL
VIGGGLTSAQIADQAIRRGATRVFHVMRGPMRVKPFDVDLSWMGKFRNHEKATFWSADTD
EERSDLIRSARGGGSITPRSVKILEKHVRLGKLSIHAHTTVEQTSHDPITQTWSIKTSPP
VTDLPAIHFVYFATGVQSDVEKLPYLQKFADKYPMKCFDGMPALTDDLMWKPDMPLFMTG
LFAALRVGPGAANLEGARVGAERIAWGLRDVLADEAVSTDEGRPSEASQGQRGCRLAAGI
SSRYESLEVE
Download sequence
Identical sequences N1PNL4
jgi|Dotse1|172765|estExt_Genewise1Plus.C_5_t30434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]