SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|68241|estExt_fgenesh1_kg.C_1_t20392 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dotse1|68241|estExt_fgenesh1_kg.C_1_t20392
Domain Number 1 Region: 121-490
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 4.12e-92
Family Glutamine synthetase catalytic domain 0.0000431
Further Details:      
 
Weak hits

Sequence:  jgi|Dotse1|68241|estExt_fgenesh1_kg.C_1_t20392
Domain Number - Region: 25-110
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0196
Family Glutamine synthetase, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|68241|estExt_fgenesh1_kg.C_1_t20392
Sequence length 492
Sequence
MAITDDSSELEHADLQELLKNDTSIKVAGVDIDGQLRGKLMSQKKFFSVVESGFGFCSVI
FGWDMHDQTYFKELKISNAENGYRDITAEIDLSSFRRIPWENNIPFFLVSFREPEGGSLS
ACPRSLLERTVDKISTNGMGALAGAEYEFFTFRTPTDSQISPKSDERNSSATATFLQKNP
VNHLPSLEEGMFGYSLTRPVHNQEWYYGIFDACSKFRCDIEGWHTESGPGVYEAALEYGE
IKQMADRAALFKLTVKSVSSKYGITPCFMAKPREGLPGNSGHMHISLKDNKTGKNLFARE
QPDSNPPFEGLENVSDIGRQFLAGVLDGLADIMPLFAPTVNSYKRLVENFWAPVTVSWGL
EHRAASIRLIAPPTSPPKGTRLEIRVAGADTNGYLVLAGILALGYRGIEKKMSIAIPPLG
KGEDVGGTGDKGQRLAKSLKEATAQFARKDSVAREVLGDDFVDHYAGTREHEVRLWDEAV
TDWEVRRYIETV
Download sequence
Identical sequences N1Q141
jgi|Dotse1|68241|estExt_fgenesh1_kg.C_1_t20392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]