SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|77466|estExt_fgenesh1_pg.C_2_t10065 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Dotse1|77466|estExt_fgenesh1_pg.C_2_t10065
Domain Number - Region: 206-228
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0641
Family Glutamine synthetase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|77466|estExt_fgenesh1_pg.C_2_t10065
Sequence length 557
Sequence
MLRYMKAYSAHSLVVLVALALYIAVQCQLGKSIRPTQDHPIVTLMRRAEESFLGLLSRQT
TTLEAAKAAYRLRRHGEPPEGFDQWFTLALRSKAVIVEDFWDPIYQDLDSYTGTPALLLR
SASDAVSNSPSLLISGFSVRAGNVSSTCQPDNKPCRQLEDMIRSVAEWLPDMNIPVNDNA
SPRVIVPSAERHGGHLDSSQSDLVHRALTSIDHKDMFTVPDADTAFWLKACSPDSPARQL
HKNNGQSQPESPDPSLTMSFVSEIHSWQNVCQQPWLRKMHGALVRPLCLNVSQNLLPIFS
SARIAGIETAILYPDAIFWAQDPDYYITSIIRNSTPWNYKSDRAFWRGSNTGGGHGPKDW
QYFHRHRFVALTNASYLSNVESGQQQDWAGVEGPVTKQMMQLAADHLDTGFSALACRDDL
FRTSNRPCSYLDAHFHPVPWVSLPTALSSYRYLFDIDGNSFSGRFHALLLSESVVLKATI
FREWHDARLIPWLHFVPLANRFGTDLWHVLAFFLANEDEASYIARSARSWALRVLRREDM
ELYLLRLLLEWARLIGS
Download sequence
Identical sequences N1PXT3
jgi|Dotse1|77466|estExt_fgenesh1_pg.C_2_t10065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]