SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|77731|estExt_fgenesh1_pg.C_2_t10381 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dotse1|77731|estExt_fgenesh1_pg.C_2_t10381
Domain Number 1 Region: 75-261
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-39
Family C-terminal domain of adrenodoxin reductase-like 0.0000122
Further Details:      
 
Domain Number 2 Region: 60-125,301-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000189
Family C-terminal domain of adrenodoxin reductase-like 0.0013
Further Details:      
 
Domain Number 3 Region: 350-452
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000388
Family N-terminal domain of adrenodoxin reductase-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|77731|estExt_fgenesh1_pg.C_2_t10381
Sequence length 458
Sequence
MYEGLPSPYGLVRSGIAPDHPEAKKCSDTLADVAKYESFNYIGNVPIGNGDGHLPLTSIA
PHYDAICFAYGASKDKKLGVPGEDLRGVHSARAFVGWYNGLPEYADLNPDLGAGDTAVVI
GQGNVALDVTRILFKPLGELRKTDISEHALEVLSKSRVRNVKVIGRRGPLQAPCTIKELR
ELLQLQGLAFVPPPESWESLLQVETKKLPRQLKRIAELLQKGSKETIDKAVNAWQLGYLR
SPVEFLSKNGYDLAAIGFEQTEYVDPMSELMTGEPQHDLNALRTAKVRGTGKRGMVGAQL
TFRSIGYESEALPGLDDLGVPFDTRIGIIPNDRHGRVLSPDLGPGGNLTAGHVPGMYCAG
WVKRGPTGVIASTLDDAFTTADIIVDDWRKNVKFNEGVGEQKGGWDEVQKETQRRGIRTV
SWRDWEKIDAEEVKRGKEKGKEREKFRTVGDMLTVLDG
Download sequence
Identical sequences N1PVL4
jgi|Dotse1|77731|estExt_fgenesh1_pg.C_2_t10381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]