SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|54324|estExt_Genemark1.C_6_t20162 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dotse1|54324|estExt_Genemark1.C_6_t20162
Domain Number 1 Region: 24-71,131-318,362-424,453-484,512-607
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.61e-51
Family AAT-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|54324|estExt_Genemark1.C_6_t20162
Sequence length 835
Sequence
MASTNTFNMATDGPANDTRPPPKDLSHHLSRVTRARHASSIKMFYKYFQIPGIGQLAGGL
PNNYYFPFDTLEAKVARPDRWQPTETRPIDPPSDEEALAALSLQEKKLKTESSPLNQPQD
AILVPHSSKQANPVKKIDLSTALQYGTAQGYPPLYYFIRQFTQQNLHPNCPYKGGPEVIL
TNGNTDGFSKVLSAFTNEWSAEKDWIRDKENILVEEFAYMAAVQAGRPRGLGIVPVAIDD
EGMVAEGPGGLKEVLERWNHKNGKRPHLMYTVTMGQNPTSGVLSLQRRRELYALCSKYDI
LIIEDDPYWYLQFPTAVATNTTTTHDPANTSFNPDVAMFANGEALPEGWKSSGYKFLDSL
VPSSINIDTDGRVIRLDTFSKTVAPGCRLGWITAQPALIERLLRVTETSTQQPSGFVQSM
IAELVLGPDHSGLDQPKVNAKGGKGPLPGGQGWKADGWVRWLEGLRGNYERRMNHMARIL
DDGKYLVKAGRRNSLSEEIADDEDEWSVVEKTQILSFEWPVGGMFLWLRVHFESHPLWSS
YKKTPERLSKALWILWTTKPFMVLVAPGSLFSPTDEIAAEKGWQFFRLCFAAINEEDLRP
VTKRIAEGTAAFFRIKDKKTIEKLLDEEDDEEARVQDREGLAMMAQMMGPSFRQYRCIME
PTWRYIGNERLVPVASAAIAGLLATRNAALIAVGGAVVLLTVVSTAFTLSGPVQTEKLGL
RFTAVNLGLLVCCVAGTYTLSLDDFICFCTFWAAAAGVYIFDRSSIGDAFLIALFTVAGS
LVATDIVQCLRYGCRPDDGQLPQLLLWTGGGLTALGAKGLEVVWVMQHGGTIGRP
Download sequence
Identical sequences M2XM64
jgi|Dotse1|54324|estExt_Genemark1.C_6_t20162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]