SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|69696|estExt_fgenesh1_kg.C_2_t20171 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dotse1|69696|estExt_fgenesh1_kg.C_2_t20171
Domain Number 1 Region: 212-628
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.48e-97
Family GABA-aminotransferase-like 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|69696|estExt_fgenesh1_kg.C_2_t20171
Sequence length 693
Sequence
MPAIRVLNPFASSPPAAPDTTTILSEKESVRIDTRESVPIKQAPRFPRPKFGLPFSGPPK
TPRAQTVAEPQQQTRLEAPQVLSFRPPSPQIPTLSLPTINLTTATGEKSKMEKAEPLTLF
QPPSPAEARRIARQHAAFGPLGSKQHLYSSRFVGTEFPEPIEDEPPYYYLITTYISYLIL
IIFGHVRDFFGKRFKPDQYKQLREHDGYAPLNSDFDNFYIRRLQLRINDCFRRPVTGVPG
RFITLLDRTSDDYNLSFKLTGTTTQTLNMSSYNYLGFAQSEGECADAAEASVRKYGISFC
SPRGDVGTSELHVDVERQVAEFVGKEAATIYSMGFVTNATIFPALVGKGCLLISDQLNHS
SIRFGARLSGAVIDMFKHNDMDALEHLLRERISQGQPRSHRPWRKILVAVEGLYSMEGTM
CNLPGLIALKKKYKFNLYVDEAHSIGALGPRGRGVCDYFGIDTKDVDILMGTFTKSFGAN
GGYIVGDKSLVDKIRVNNAGTIFGECPTPAVLSQISSSLRIIAGELAPGQGEERLQRLAF
NSRYLRLGLKRLGFIVYGHDDSPIIPLLLYHPAKIPAFSHEMLKRKIAVVVVGYPATPLI
SSRARFCVSAAHTKDDLDRLLAACDQAGDILQLKFSSGIAGGQEPIPDGLTNQEEVDIRS
CLEAGGKPAVTPPRWKLSDVVRRGVQDVKKPLC
Download sequence
Identical sequences N1Q042
jgi|Dotse1|69696|estExt_fgenesh1_kg.C_2_t20171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]