SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|69816|estExt_fgenesh1_kg.C_2_t20295 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dotse1|69816|estExt_fgenesh1_kg.C_2_t20295
Domain Number 1 Region: 149-489
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.51e-78
Family IF2B-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|69816|estExt_fgenesh1_kg.C_2_t20295
Sequence length 495
Sequence
MTEQQKPEQPAAEEQKLSPAELKKRAKAEKQARRAAQKEQTGAPAGGPPAEEAATNGEPK
LSKQGGGGGGGGPAQQKPKGEKQQQQQPKGAQKQGDQGKNQGGAEQASLPVRNRRGSQSA
PKESVTRQENKQVELFSHLYNQPRRQTLEGISKDVHPAVLALGFQMSSYEICGSSARCVA
MLLAFKEAIQEYTTPAGTSLARHLTSHYLSPQIDFLKSCRPISESMGNAIRWLKKLIVEV
DPDVPEHEAKDQLWNDIDRFIMERITATDQAIASSASGLIKDGSVVLTYAKSSIVEKTIL
QAHAVGTKFRVVVVDSRPLFEGKNLATSLMNAGLQVEYYAFAGLARAVSDATLVLLGAHS
MLSNGRLQARIGAASLAAAAHRVDIPVIVCCGSVKFSGKVALDSIVINEVAPAEELLLPA
KTQLSIPTAKDAKNDEGEETKLKSLHDWKDIHNLQILNLMYDITPAEYIRMVICEYGSVP
PSSVPVVHRLANEGI
Download sequence
Identical sequences N1PWU6
jgi|Dotse1|69816|estExt_fgenesh1_kg.C_2_t20295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]