SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|71877|estExt_fgenesh1_kg.C_5_t10361 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dotse1|71877|estExt_fgenesh1_kg.C_5_t10361
Domain Number 1 Region: 70-117,156-530
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.56e-72
Family AAT-like 0.0000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|71877|estExt_fgenesh1_kg.C_5_t10361
Sequence length 573
Sequence
MAPPAATIDLDICPEIGSATFITVPDRLTVDKVAKRRAASGKLVAGVAAVADLEQFKGRT
SHSHKALAKRWDHRLSHETQSRGGSSLKIAARYLKTPGIISLGGGLPSSDYFPFSEIDVR
IPRLGHCAQGKEGSDVVRAGMHDMAEGKSAFDIATAAQYGLGHGAAQFLRWIVEHTEICH
NPPYRDWSCTMTVGSTCAWDFALRMFCKPGDWVLSEQYTFPAAVETAAPMGVRFAAVKMD
SHGMLATDLDNVLTNWDPRKGPKPFLLYTVPTGQNPTGSTQDIQRRREIYAVSQRHDLVI
FEDEPYYFLQMEAYKGPEGSPAPGPSSHEEFLHSIVPSFLSIDVDGRVMRSDSFSKVIAP
GTRVGWITASEQLCDRYRTHADVCSQGPSGFSQLILYKLLDEAWTHAGYLDWLMYMRMEY
TNRRNVMMQACEKYLPKEIVSWVPPMAGMFHWLQLDYKKHPHYETQTFDDLEEEIFQSII
AHGTLLMKGSWFCADRAAKRDTMFFRATYAAAPFDKIDEAIKRFGEAIRDTFELEAPMNG
HAGSLRDGLAKLALMNGTGGPVKVSHDHTEVVC
Download sequence
Identical sequences N1PPA0
jgi|Dotse1|71877|estExt_fgenesh1_kg.C_5_t10361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]