SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Dotse1|72061|estExt_fgenesh1_kg.C_5_t20058 from Dothistroma septosporum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Dotse1|72061|estExt_fgenesh1_kg.C_5_t20058
Domain Number 1 Region: 25-110,242-476
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.94e-67
Family IF2B-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Dotse1|72061|estExt_fgenesh1_kg.C_5_t20058
Sequence length 490
Sequence
MPAPAVGTRPSLRTFLYNLKHSDNVESSIALLVSLLKFRQIAHSRPCAIATTRLLLQVVA
ARRWSSSKDLERRIREVGERLQAAQPREMAVGNIVRRVLGIVHEVAEDDQDTTSTNDSQE
LPASPAVNTGVSTHRPKLPTNISEFSPLHQGAALPHSAQPHASSAASSPSINGTTESPPR
RPALTAVASSYAGQGPHGSLFGILTQPQGLASIGGSPPDSGTTTPVPKSAKNQDESKEKL
DIKAEVIDGIKDLLEELDIVDSQISEYALDHIHSNEIILTHTSSQTVQRFLSAAARKRKF
TVIHAEAYPNNHEETHSTVINGSQKAGEDEDPNERWKTLTSMGIKVIVIPDSAVFALMSR
VNKVIMAPHAVLANGSLIAAAGASTIAQAAKAHQVPVVVLSGVYKLSPVYPFDMSEMIEY
GDPGKVVPFQDGPFMDKVDVINPLFDWVDADLVNLYITNLGAHAPSYLYRIVADHYRTED
IDLTAKVQEN
Download sequence
Identical sequences N1PM75
jgi|Dotse1|72061|estExt_fgenesh1_kg.C_5_t20058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]