SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fomme1|126837|estExt_Genewise1.C_8_t50228 from Fomitiporia mediterranea v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fomme1|126837|estExt_Genewise1.C_8_t50228
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily ITPase-like 8.11e-57
Family ITPase (Ham1) 0.00000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fomme1|126837|estExt_Genewise1.C_8_t50228
Sequence length 208
Sequence
MSNRTLVFVTGNANKLKEVRAILSDTSDGSAPINLESKDFNIPELQGTTQDVAREKCRRA
AELVGGPCITEDVALCFKAMNDLPGPYIKHFLKALGPGGLSTLLEGFPTNDAYAICTFAY
SAGPGTEPILFEGKTQGKIVSPRGPQDFGWDCAFEAEGTGKTYAEMRSDEKNKISHRSRA
LALLRAYLKDLPLEADIQGHSHAEATLA
Download sequence
Identical sequences XP_007268977.1.56834 jgi|Fomme1|126837|estExt_Genewise1.C_8_t50228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]