SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fomme1|17284|fgenesh1_kg.2_#_366_#_isotig10158 from Fomitiporia mediterranea v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fomme1|17284|fgenesh1_kg.2_#_366_#_isotig10158
Domain Number 1 Region: 24-236
Classification Level Classification E-value
Superfamily ITPase-like 1.63e-41
Family Maf-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fomme1|17284|fgenesh1_kg.2_#_366_#_isotig10158
Sequence length 248
Sequence
MTPKHQAIKPHALKVPGLVKLSGKRVVLASASPRRKEILANFGIEPEIIPSTFEETLPQS
SFEDVHEYPVATATQKAVEVYERLVAENPDDPPDLVIGADTIVLTHIPPAQSDLHSSLLP
SSRPEILEKPISKADNLRMLLDLNGAVCEVVTGVSLVYPILAAPGYQIKSIDERTIVHFA
DSPTHVLEAYADSGEGLDRAGGFAVQGLGGVLVRKVDGDYNNVVGFPAASFLKFLDSLVE
EEDGFLDV
Download sequence
Identical sequences XP_007263076.1.56834 jgi|Fomme1|17284|fgenesh1_kg.2_#_366_#_isotig10158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]