SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi1|89600|gm1.7691_g from Fomitopsis pinicolav1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi1|89600|gm1.7691_g
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily ALDH-like 6.41e-31
Family ALDH-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi1|89600|gm1.7691_g
Sequence length 218
Sequence
MSTPLAYTPIEEIPRIRETLKQGFATGKSRDVKWRKKQILQLWHLVEDNFDRMRKALFDD
LGRAPDESDGTELNSLVLEIKAAYDNVGTWSQTEKASWHYMWFAMSPATRIEPKGVVLLI
TPFNFPLYLLLAPFAAAIAAGNACVLKPSEGSTACAALLTNLFPKYMDQEFFQVVNGGQQ
RYGNSLMWLGAYCHGWDVCGDEGLEDGLSAGRSGDRAC
Download sequence
Identical sequences jgi|Fompi1|89600|gm1.7691_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]