SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi1|101772|estExt_Genemark1.C_820014 from Fomitopsis pinicolav1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi1|101772|estExt_Genemark1.C_820014
Domain Number 1 Region: 300-540
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000085
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number 2 Region: 625-814
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000163
Family Tropomyosin 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Fompi1|101772|estExt_Genemark1.C_820014
Domain Number - Region: 1251-1354
Classification Level Classification E-value
Superfamily Tropomyosin 0.000615
Family Tropomyosin 0.015
Further Details:      
 
Domain Number - Region: 1025-1129
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0249
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 549-617
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0497
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi1|101772|estExt_Genemark1.C_820014
Sequence length 1585
Sequence
MPTRRRLQLYQVLVSLIATGYTLANPPRCVEEHLRSLEALDNLVLYYFVLGGYASLVFYF
FHWSMSSLITPRTFGHFRTLLTAFNAPLLRYAIDEYFNSHLNLQYRDHLIETMLDRELRD
AQHTRTIATLQQHNDSLNTQLDTAHDKHRNALNALREHKFKLNGQKATAKDLRIRLKEQQ
ALVNARNARVVELETDAANLNTNVADLRTQLDATEADAVKHETSATEWQARALKEGAKAE
KLKVKLERKREDRDAWMDRALSSAEKAREFQDLASHNAKVARGYCERIERQEELNRKAGD
KISAYRYRVREAEAKVDDLETRTVELEGWNEKWRARADAEEAKAGRLASELDEWKEHAQQ
LEDTVAEWKARSTMQEAEASDLEARNVKLEATVADLQDEISDLETRATGFEATAADWESQ
ARHHENDATEWKARATEEGNKVSGLNASNLALQATVADYETKVKSLNNDVTELAAKAADW
ASKARDYENEAVEWKTRATERQAKADVLETRKGELEAEVGELKSGIAERDLRALALVAEV
DEVKAVSGNHENASVEWHARATEQQTRADDLEARTRELETTLGNVNARLTERDTLVATLT
TRGSELEATVRDADARVLELGALVNTWKTRAETNEDVANERKTRTTELESEIKSLNTYKE
DLESRAVNMETRASEAEASAAHWEARAESDAAKVVDLEGRILDLEERVISSEFEMLGSKE
DADEWKACAHEHEVRADNLGVRIAELVSDVGERDSRILDLEAAIQDRDANIVATKLATSE
WKARALESEARVSHAEGRVCDAEVTAHKLETDLTASHQVVAVFIDRFLQGRDVIADLTRR
NTSISQTNKELKARAAALEAGAADWEARAESEVAKVIVLEGRILDLEEKVISSEFEMLGS
KEDADDWKACAREQEVRADNLGGRIAELVSDVNARDTRICDLEAAVQDRDANIAAIKLAA
DEWKAHALESNIHAEGRVRDAEITARELEADLTASHQVVAVFIGRFLEGRDAIADLTRRN
ASISETHKEVKARSVVLERDAQKSQVEFVRTRAALDDQREVNNALKSEVAAFATQRLTWK
TKLAASEAQGKGIEAQLSEVRKELAAEKDGSTWLSSEVSSLSHRLHSTQGELRASTTQIE
GAKAELSRTVKELDAQKKANVELDNARNALQTKQIATPVRVQALKAQPSTSRSTPASPQP
HGTPSKVRNVPASKQATPKALMPGAKSTLTRTAGLRENQNIANTDSTRANDALKAELAAS
KKDIGTLESQLAASEERVEDLQAQLATSGGELDGVKAKLAKAETAWAAHESDSEAIAAME
RVQAAEKELTETKVRLDDWEATVVRLSQRVTDVELERAMHMCQPLAPEGKTIDEDAQAIV
ATPVASDVVAVQGLIVALAHLRKQCKAEAEAKEKLAAEQTMARTLSRVAHHALDYSDEQV
DAIRAERAAVYRQMQLERYKRDVEESKVDELTARNHELTWALRKVEQYLRDEGLYNSEDE
DEDELEDDSMEADEDDFMEGDSMEVHEGYSMEGDEGDPEQAVDASNSPEEAHSGTNEATE
DDPNEADEAVTMRAMQPVESPATTA
Download sequence
Identical sequences jgi|Fompi1|101772|estExt_Genemark1.C_820014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]