SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi1|134498|estExt_Genewise1Plus.C_5_t10232 from Fomitopsis pinicolav1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi1|134498|estExt_Genewise1Plus.C_5_t10232
Domain Number 1 Region: 10-181,223-373
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-80
Family G proteins 0.000000978
Further Details:      
 
Domain Number 2 Region: 939-1050
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.79e-28
Family EF-G/eEF-2 domains III and V 0.00062
Further Details:      
 
Domain Number 3 Region: 693-744,785-936
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.36e-24
Family Translational machinery components 0.0068
Further Details:      
 
Domain Number 4 Region: 385-428,500-590
Classification Level Classification E-value
Superfamily Translation proteins 7.06e-21
Family Elongation factors 0.0047
Further Details:      
 
Domain Number 5 Region: 615-691
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 7.55e-17
Family EF-G/eEF-2 domains III and V 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi1|134498|estExt_Genewise1Plus.C_5_t10232
Sequence length 1073
Sequence
MASNPQAIDVRNVTTIGHVDHGKTTMMDALLAANNIISTRMAGKIRYLDSRLDEQEKGIT
MESSAVSLRFKVMERNEAGGIYPKTYVVNMIDTPGHVDFSSEVSTASRLCDGALVLVDVV
EGVCTQTITVLRQAWQDRLRPVLVINKFDRLITELKLSPMEAYHHLSQLIEQVNAVMGSF
FASERMEDDLRWREERERRLAEKKESHAEEIDAAINDVHEFQERDDEDIYFAPEKGNVIF
ASALAGWGFRIGKFAHLYAVKLGIKETNLRNVLWGDFYLDPKTKRVISHKHLRGRALKPL
FVQFILDNIWAVYDAVLLNPNPEKVTKIVSTLNLKIPPRELNSKDSKQLLTLICAQWLSL
SSCVIQAIVDVVPPPSIAQRTRIPKMLYPDIYESTVEPKNKMEENLYSCDARPDAYVVAL
VSKMFAIPAKELPGNKKKPLTADEMRARAKAAREARAAQAAAANGEPAPSEASSAPLESA
LEQMSVEDKELEGAGEADEADETLLGFARIYSGTIRTGTTICCVLPKYNSALEPTHPRNA
PHVVTTKVEALYVMMGRELVPVDQVRAGNVFAVQGLEGKVWRSATLCAPGELGVPDGTDL
DQVKDCLLNFGGVIRYAAPIVRVALEPEVPADMPKLIRGMKLLSQADPCVETFQQQTGEH
VILTAGELHLERCLRDLRERFAKVEINPSEPIVPFRETAVKAPDMAPPKTPGTKRGTIQG
AITNNLIKYTIRAAPIPTALVEFLRDNLATLKRMEQEQGTADGGPSTRENGYEEEDYDAQ
GEVTRKPSIKPEDFWRGLQEACQKAGGDWAEVVDRIWAFGPQKAGSCMLIDARPGGQPNA
LTRRRERAQTGEERDTLLRDLDNHLEAGFQLATFQGPLCAEPVEGLAYFVESVEVDREGI
EQERQHNRMAQVTGAFITSVREACRNGLLDWSPRLMLAMYTCDIQASTDVLGKVYGVVAR
RRGRIVSEEMREGTEFFTVRALLPVVESFGFADDIRKRTSGAASPQLIFSGYEMLDLDPF
WVPTTEEELEDLGEKADRSNIAKGYMDSVRERKGMFVDRKIVEHAEKQRTLKR
Download sequence
Identical sequences S8EQH5
jgi|Fompi1|134498|estExt_Genewise1Plus.C_5_t10232 jgi|Fompi3|1111715|e_gw1.3.105.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]