SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Glotr1_1|109249|estExt_fgenesh1_kg.C_00001_t20057 from Gloeophyllum trabeumv1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Glotr1_1|109249|estExt_fgenesh1_kg.C_00001_t20057
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily CinA-like 0.000000000000549
Family CinA-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Glotr1_1|109249|estExt_fgenesh1_kg.C_00001_t20057
Sequence length 150
Sequence
MLLGGIVAYSNPVKQKLLNVDPAILDEQRGPGEVSKECALAMARGALHNVGVLDVEGQGV
GISTTGFLNGGPPGREGEVWIGCCWKFKDSTGSRAKQYWVKNGKGSIDGQEHEEAADQRD
QEKLWVVDKALDLLTEVVEELESKAKAGKL
Download sequence
Identical sequences S7QNB9
XP_007861269.1.11637 jgi|Glotr1_1|109249|estExt_fgenesh1_kg.C_00001_t20057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]