SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Glotr1_1|141628|estExt_Genemark1.C_000650002 from Gloeophyllum trabeumv1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Glotr1_1|141628|estExt_Genemark1.C_000650002
Domain Number - Region: 309-343
Classification Level Classification E-value
Superfamily CinA-like 0.0981
Family CinA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Glotr1_1|141628|estExt_Genemark1.C_000650002
Sequence length 519
Sequence
MADLYPDKEKAASSSDGGVAVTEAHIEERAPETVIVQRFGRFGGWMAKLFDHGVEARGIE
RVPEDERESKNVWNNLLMWWSVNTVLTTIPIGVLAQEFYTLTFPHAVATIMCFGALGGVC
TAFIATLGPQTGLRTMVITRFSSGYVGGTIYSILNILTQLGFSTTAVILGGQTLASINPG
TLPLVVGIIIIGLCSLVPCFIGYNMVHIYERYAWIVTFIVMLFLWGLGGRAGFDIGAQKG
LEDHGRALSADVLSFGGIVFGSFTGWAPVAADYNCRLPVSTPPLKVFLLTFFGLFIPICF
VEILGAALMTITDPAYTSAFAEGSTGGLLGQVLSPWKGGGKFVLVLLALSVVANNIPNTY
STALSIQALARPFALIPRFVWTLLAFAIYTIAGVAGREHFSEILSNFLSILSYWTAFFIV
IVAEEHLIFRRRGGPLGGYNLADYDTPGRLPLGVAGILAGCFGVAGAVVGMSEVWYTGPL
GRDAGTELYGADLGFELAAGFAAVTFLPLRYLEIRLTGR
Download sequence
Identical sequences S7PRU9
jgi|Glotr1_1|141628|estExt_Genemark1.C_000650002 XP_007871443.1.11637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]