SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111114920|ref|YP_709538.1| from Borrelia afzelii PKo

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111114920|ref|YP_709538.1|
Domain Number 1 Region: 301-511
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-37
Family ABC transporter ATPase domain-like 0.00052
Further Details:      
 
Domain Number 2 Region: 83-287
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.000000000209
Family DNA repair protein MutS, domain III 0.031
Further Details:      
 
Domain Number 3 Region: 702-777
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000196
Family Smr domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111114920|ref|YP_709538.1|
Sequence length 778
Comment DNA mismatch repair protein, putative [Borrelia afzelii PKo]
Sequence
MQDKYLKNIDFYEILSLVSKYVSNPDTVNLLNNQKILKTRESLEKMFSFVNLIRMLFETC
KGYPNSFINSLKYPISLLSKENSRVSIENLRDIVRFLDEVLRINLFLDKNGDTKYFNAHI
LSDLLFLSPELKNLLSELKEYIDFDTLELKSGVVKEYDSIEFEIKNLNRRVEKQIKKIIS
LNVEYLASNFVYYKSNKYTLALKSNFKSKIKGNVISISSSGETFYIEPNDIVNDNNRLNY
LSLEKKRIILKILQNLSSKVHSNIVFLDNLYNNFLYYDSLKARAIYGIETKGVFPEISDV
LNIFDAHHPLLKDSKAITFTPIENRVVIITGPNAGGKTVTLKTIGLLSAMFQFGIPIAVS
ESSTFKIFDNIFIDIGDEQSISNSLSTFSSHMSNISYILKHATKNSLIIFDEFCSGTDID
QGQALAISILEYLISINSYVLISTHYNALKYFAYTHEGVINASMRMDLETMQPNYDLIFS
IPGESYAFNVASRVLIDSNIIIRANEIYSSQKTEVNKILERLIEKEKDLLFIKESMNEKL
IQIELQKKEVENICQDLLLKEKNIEIELLNEQNEFLKNSRKVLENLVREIKEGNINVAKN
KAFISDLEKNIDFKSNKVSSLNNKRNVATDFKIGDKVRIVNSNAKGKIVGISKKKITVNV
GAFNVSVSSSEISLENFTEHKKEGSKNFSFSIDYNKEDMLSFTIDIRGMRAIDALDFLNK
KIDNIILNGINKFEIIHGKGEGHLMREVHSLLKDLKFVKKYYFAHPSDGGAGKTIVEI
Download sequence
Identical sequences Q0SP66
390236.BAPKO_0099 gi|111114920|ref|YP_709538.1| gi|111114920|ref|YP_709538.1| WP_011600832.1.79404 WP_011600832.1.94617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]