SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111115243|ref|YP_709861.1| from Borrelia afzelii PKo

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111115243|ref|YP_709861.1|
Domain Number 1 Region: 187-371
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.14e-60
Family Methylesterase CheB, C-terminal domain 0.00000663
Further Details:      
 
Domain Number 2 Region: 4-104
Classification Level Classification E-value
Superfamily CheY-like 0.00000000161
Family CheY-related 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111115243|ref|YP_709861.1|
Sequence length 375
Comment protein-glutamate methylesterase [Borrelia afzelii PKo]
Sequence
METKISVLIIEYFAVKRKLISDLINSSPKLQVIATASNGKFATNKLKKHNPEVILMNLEE
NNIKDILFLEKKNNINKTIPIVVTSSNQNLINIAALKGADDFILVSKNKKSHENQKEQII
NSLLAYGSISIKNKIVRNKDIKIKNNERADFFLNHKNDTFSLPQLEEHAKEKILNEKEIK
KLRLRKFDIIAIGVSAGGPVALKSILPEIPESFPPIIIVQHMPQGFTEEFAKNLNNLCKI
RVKETTNKETLKQGHAYISSGGYHTKIKKIDGNYQVQTFDGKHINGHKPSIGVLFQSIAD
IAKDKAIALIMTGMGNDGSKEIGDIKKAGGLTIAQDKESSMVFGMPKIAIKENNIDYIVP
LNHMVKLLKAILINS
Download sequence
Identical sequences Q0SN93
gi|111115243|ref|YP_709861.1| 390236.BAPKO_0431 WP_011601011.1.79404 WP_011601011.1.94617 gi|111115243|ref|YP_709861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]