SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Picme1|102169|estExt_Genewise1Plus.C_5_t30480 from Pichia membranifaciensv1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Picme1|102169|estExt_Genewise1Plus.C_5_t30480
Domain Number 1 Region: 11-189
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 2.09e-35
Family Peptidyl-tRNA hydrolase-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Picme1|102169|estExt_Genewise1Plus.C_5_t30480
Sequence length 206
Sequence
MPPLRTPPQRLLVLSLGNPKEYDGTRHSVGHYVLEKLVSRYRCQQERVGRFESHVLHHRG
PENSCDVWFYRVPGYMNLAGKSVAPFYDAFCRQDPQTPTPVVVLFDELDVELGDVKIRKR
NSSHRGHNGLRSIQSSSRIGKEYTGLQLGIGRNYAGDKNTPGVVANYVLSKFSGAEREVL
DDEVVGKVQDILEQMCEQGKYLNESL
Download sequence
Identical sequences jgi|Picme1|102169|estExt_Genewise1Plus.C_5_t30480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]