SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Picme1|57510|CEP2090_5208 from Pichia membranifaciensv1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Picme1|57510|CEP2090_5208
Domain Number 1 Region: 133-417,462-513
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.43e-82
Family IF2B-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Picme1|57510|CEP2090_5208
Sequence length 517
Sequence
MSEQPPVAEQKKKEKEQPSSGGGSASSPSVSSDAGGEKQLSNKELKELKKREKAAKRAAA
KEAAGIDPSANAQGKGKETPGGSGSSKDKTPKTVSHIKKQLNNAKIHDPTMKIPHMFGHL
ETREERISSTPKIASIVHPSILSLTLKISTYKIVGSSARCTAMMEAFKDVIGSYVTPEGA
SLQRHLTGHLSHQIEYLKTGRPLSISMGNAIRWLKQRISIIPITTSEEQSKSMLIEEINQ
FIMEKIVMADRVIVEYAEGHIINNFKILTYGHSNVLAELFEFCAEEQNKKFEIYIIDSKP
LFEGKKLAKKLSKLENIKLHYNLINSLSSVLEKSNIDFCFLGAHSMLSNGRLYSRVGTAL
IAMAAKNKSIPVLVCCESLKFSDKVQLDSVTLNELGDADDLINTKPFNKTGFNLQQYLDT
LNNKMLMEKENNSKGKKGGNNSNKNNKQQQQPQQEKSKEKEEDEYDLSNWKSYPSLNILN
ILYDLTPPEYIQKIITEFGALPPSSVPVILREYKSAT
Download sequence
Identical sequences A0A1E3NRT6
XP_019019928.1.70258 jgi|Picme1|57510|CEP2090_5208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]