SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Punst1|128510|estExt_fgenesh1_pg.C_200009 from Punctularia strigosozonata v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Punst1|128510|estExt_fgenesh1_pg.C_200009
Domain Number 1 Region: 23-233
Classification Level Classification E-value
Superfamily ITPase-like 5.75e-41
Family Maf-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Punst1|128510|estExt_fgenesh1_pg.C_200009
Sequence length 246
Sequence
MPKHNCILSHAAALPSLKKLAGKRVVLASNSPRRREILRTFGLEPEIVPSTFEENLPVGS
FEDIHEYPVATATQKAVEVYQRLLEENPDDAPDLVIAADTVVFTHAPPSTSDATYGTDSG
PQDLLEKPTSKEDNMRMLLDLNGGICEVVTGVTLVYPTLVAPGYDIKSIDERSLVYFSDS
PQHVLKAYVDSGEGLDRAGGFAIQGLGGMLIRKVDGDYNNVVGFPAASFLRFLELLVDEE
DDFLAD
Download sequence
Identical sequences R7S3W5
jgi|Punst1|128510|estExt_fgenesh1_pg.C_200009 XP_007388715.1.86435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]