SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407463910|ref|YP_006774792.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407463910|ref|YP_006774792.1|
Domain Number 1 Region: 365-518
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.31e-59
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000294
Further Details:      
 
Domain Number 2 Region: 167-358
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.26e-58
Family Actin/HSP70 0.00000342
Further Details:      
 
Domain Number 3 Region: 2-163
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.98e-50
Family Actin/HSP70 0.00000717
Further Details:      
 
Domain Number 4 Region: 512-589
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000000000288
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407463910|ref|YP_006774792.1|
Sequence length 629
Comment chaperone protein DnaK [Candidatus Nitrosopumilus sp. AR2]
Sequence
MTKIIGIDLGTSNSAAAVVMGGKPTIIPAAEGATVAGKAFPSVVAFSKDGDLLVGEPARR
QAVTNPDRTIVAAKRKMGSDHVFKILDKEYKPQQISAFILQKIKKDAEAFVGEPVQKAVI
TVPAYFDDNQRQATKDAGTIAGLDVVRIINEPTAASLAFGLDKSKEDMKILVFDFGGGTL
DVTIMEMGGGVFEVLSTSGDTQLGGTDMDKVLIDFIVDEFKKKEGVDLSQDSTAMTRIRE
AAEKAKIELSTVMETDVNLPFIAHDPSTGAKNLELRITRAKLDELIGPIVERCKPSVLKA
LEDAKLSNSDINKIVMVGGPTRIPLVKKFVSELVGQESESGVDPMEAVAMGAAIQAGIIA
GDVSSDIVLLDVTPLTLGIETLGGVREPLIERNTTIPTSKSKVFTTAADNQTAVTIHVVQ
GERPMATDNVSLGSFNLTDLPPAPRGVPQIEVKFDIDANGIINVTAKDLGTQKEAKITIE
STSKLSKEEIEKLKEDAEKFSDEDKKKKEKIDLRNEAESYIYTTEKLVNHDLKDKISQEQ
GIKITDAVKEVREVLDKEPDELKPKLETLQTLVNEVTTELYKNASPPPGADGQQGADGQQ
GADGQQGADGQQGADESSKSSQTNETKSN
Download sequence
Identical sequences K0BA50
gi|407463910|ref|YP_006774792.1| WP_014964222.1.40567 WP_014964222.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]