SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407464176|ref|YP_006775058.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407464176|ref|YP_006775058.1|
Domain Number 1 Region: 4-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.02e-36
Family GHMP Kinase, N-terminal domain 0.00031
Further Details:      
 
Domain Number 2 Region: 171-310
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.86e-30
Family Mevalonate kinase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407464176|ref|YP_006775058.1|
Sequence length 313
Comment mevalonate kinase [Candidatus Nitrosopumilus sp. AR2]
Sequence
MKSKASSPAKVILFGEHFVVYGVKAILCAINKRITVTAETIQENKISIKSNIGNLELEPN
KEISEINSPLRPFYYLANKLIKNQNTGIQVYVESDIPLGVGLGSSSACCVAGAAAISRLF
KRTSKEEILKLAIEAERTIFENTSGADCTVCTYGGIMEYDKKKGFNKIKYEPNFHLVIAN
SEIEHSTKSIVDSVKQFKEKNEDEFSELCKKESKLVEDVSELLKENNIIELGNKITENQE
YLEVLGISNEKLRKMIQIGQSKSFGAKITGAGGGGCIFALTNESNLEQTMNEFKNKNYDC
FSVKIDFKGLDTF
Download sequence
Identical sequences K0BCL4
WP_014964488.1.40567 WP_014964488.1.82955 gi|407464176|ref|YP_006775058.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]