SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407464178|ref|YP_006775060.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407464178|ref|YP_006775060.1|
Domain Number 1 Region: 130-403
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.81e-70
Family Enolase 0.0000162
Further Details:      
 
Domain Number 2 Region: 3-127
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.67e-25
Family Enolase N-terminal domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407464178|ref|YP_006775060.1|
Sequence length 412
Comment phosphopyruvate hydratase [Candidatus Nitrosopumilus sp. AR2]
Sequence
MAKISSIEGRILYNSRGSKTIEVDVKSDNQFLGRVCAPSGASVGKYEAVSFPDGKPEKSL
KILKENSQKFIGLESSDLRGVHDVLKSLDDSANYSVVGGALAFAVTIASMESASKALGEP
LFKTLSSESSFKFPFPLGNILGGGAHAGPGTPDIQEILICATGSKTIEDAIETNLSVHKE
LRRVLEKEDPSFTNGRGDEGGWAPKLENQKALEISAKACENLGFTLGKEVSLGVDFASST
QWNEEKGKYVYDRAGFENSTGEQIDFAANIIEKFKLIYAEDAVHEEAFEDMSELTKRFPN
TLVAGDDLIVTNKNILKKAIDLKSCNAAILKVNQAGSLFDALEFANEATQNNIKLITSHR
SGESTDSQISHIGLATKSKMLKVGIVGGERVAKLNELLRLSEHDLIRGMAEI
Download sequence
Identical sequences K0B7H8
gi|407464178|ref|YP_006775060.1| WP_014964490.1.40567 WP_014964490.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]