SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407464251|ref|YP_006775133.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407464251|ref|YP_006775133.1|
Domain Number 1 Region: 38-220,365-467
Classification Level Classification E-value
Superfamily Subtilisin-like 1.26e-79
Family Subtilases 0.0003
Further Details:      
 
Domain Number 2 Region: 247-352
Classification Level Classification E-value
Superfamily PA domain 0.00000000000000112
Family PA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407464251|ref|YP_006775133.1|
Sequence length 679
Comment peptidase S8/S53 subtilisin kexin sedolisin [Candidatus Nitrosopumilus sp. AR2]
Sequence
MDRKFVKLLLAFSTILIFTVILVLSQLETQNESELYLDRSVPYIGVDIPRMEGIDGAGIK
IAVIDTGVDYNHPDLFGWGPDGKVIGGYNFIRENETPLDTNGHGTQVAGVIAADGEMSGV
APKAKILAYKVSEDGEGVSSDLIIRAIQKAIEDDADIINISLGVNRTNAKIDRAVNEALE
KEIFVVTAAGNDGPELETIGSPGRNFGSVTVGATYNNLTSSLVATLEIDEKPYTVIPMVG
STKLEESIIAKIVSAGYGKIEDFEKVDVKDAIAIVERGSDVEGELLYFSIKEKNAADAGA
KALIVYNNNPGIFLGELIHEFIEPDYAPRIPVVSIDREEGLEIKESITEKSSGILQLFYN
PDFVAHFSSRGPVSPFYIKPEIVAPGAYINTTQNNAGYNFTSGTSYAAPHVSGAAALLLQ
KNPELHHHEIKSLLLTTVEPVSDAYEQEFSIHEAGAGRLDIANAFNAKLIIEPPNFVAIA
SSDDRIVEKQFQLKSTDGSWGGFDVTFDGPEFVKFGGVLDGDILKIKMSITEDNFGDHEG
TMMISHEGIQYRVPFLLHYTPGSVSVNQQNEKLSFDIYHPEEWSFAKISVINSKDGSVHT
TTATPDKKASIDVYENSLYWVDAKIRVNGTTSSAFNVIEINSLDENQQIPGITDIPEKQI
FIIGSIVIAIAVFGVLKRK
Download sequence
Identical sequences K0BCT9
gi|407464251|ref|YP_006775133.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]