SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407464530|ref|YP_006775412.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407464530|ref|YP_006775412.1|
Domain Number 1 Region: 128-216
Classification Level Classification E-value
Superfamily AlbA-like 0.00000000000000109
Family DNA-binding protein AlbA 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407464530|ref|YP_006775412.1|
Sequence length 216
Comment DNA-binding protein [Candidatus Nitrosopumilus sp. AR2]
Sequence
MKLSNTKKSKDAEDILSEFGSRIKPEPEPEPEPEPEPEPAPEPEPAPEPEPAPEPTPEPE
PEPEPTPEPEPQLEAPEPEPQLEAPEPEPQLEAPEPEPQLEAPEPEPQLEAPEPSAANAS
ETRKVPEERDVIFVGTKPIMTYVSATLTQLSTRPTVTIKARGKRITQAVDVSQMIVKRMN
SVGYVISDVRISSDSLTSQDGKQRNVSTMEIDISKN
Download sequence
Identical sequences K0BBW3
gi|407464530|ref|YP_006775412.1| WP_014964842.1.40567 WP_014964842.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]