SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407464555|ref|YP_006775437.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407464555|ref|YP_006775437.1|
Domain Number - Region: 172-228
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0366
Family V-type ATPase subunit E 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407464555|ref|YP_006775437.1|
Sequence length 252
Comment hypothetical protein NSED_03445 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MKISKIVLYDEPTVPEIQLEKIREFISNALNIEVEVKGNFFESIDHDMCKKIATTRIFDL
KNPFKVHTPSTEEIQIETQNKDMSNRKEMTLYDGFELQNIISKHIPSIENTLHIILTNKL
TATFDQNDFRYHARSLISSNPTIISTAGIIEAPAKPKQYYLDLMTNFSENRVEEVMKKYK
GEFLEYHDPRLYEILEGYVLQAILYYKTGEAFCDKKECRLFNAHWQKDLFYSQIENKKIC
KHHQEIINDFNN
Download sequence
Identical sequences K0BBX9
gi|407464555|ref|YP_006775437.1| WP_014964867.1.40567 WP_014964867.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]