SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407464600|ref|YP_006775482.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407464600|ref|YP_006775482.1|
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily Bet v1-like 0.0000000714
Family Atu1531-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407464600|ref|YP_006775482.1|
Sequence length 126
Comment hypothetical protein NSED_03670 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MGRSRTITMTVKKKTGDAFDAILNMPSKMMPDAKINDAGWWSFTGPHGKSKLKFNENKSL
GILDHQFIDEESSWNVPMRVVSNGDVSEIIVTLNKPDEITDEQFDQRMDEINEMFSSMKN
IIESES
Download sequence
Identical sequences K0BC10
gi|407464600|ref|YP_006775482.1| WP_014964912.1.40567 WP_014964912.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]