SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407464640|ref|YP_006775522.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|407464640|ref|YP_006775522.1|
Domain Number - Region: 63-123
Classification Level Classification E-value
Superfamily E set domains 0.0147
Family Filamin repeat (rod domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407464640|ref|YP_006775522.1|
Sequence length 188
Comment hypothetical protein NSED_03870 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MMYGISYCMKYFLIFLVLASTIMLVPHVSGLLIDPYTTHNELNQVIATGDSFMFTMNGKD
LERPLGFRLQYQNEDDVLKVKIKDPNGNLVLTSITYDINEYQKSISTEFTPEYKGAYQVE
VINIGQSNVSLSGYHGEMLTWKEIDAIQKEHGYSNEPHDPISVILLFLLIGSSAGFVSGY
FVSGRIRK
Download sequence
Identical sequences K0BC37
WP_014964952.1.40567 WP_014964952.1.82955 gi|407464640|ref|YP_006775522.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]