SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407464758|ref|YP_006775640.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407464758|ref|YP_006775640.1|
Domain Number 1 Region: 87-186
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 6.54e-22
Family Ribosomal protein S3 C-terminal domain 0.00075
Further Details:      
 
Domain Number 2 Region: 10-94
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 5.76e-20
Family Prokaryotic type KH domain (KH-domain type II) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407464758|ref|YP_006775640.1|
Sequence length 262
Comment 30S ribosomal protein S3 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MSAVKNVIKDNYNMMLLKDYLREAIKDAGFSHAEISKTPVGTRVALHVTRPGIVIGRKGS
GIRALTDKLASDFGLKNPQISVVEIEKPELAPSVMCNRMASHLERGTAFRRATMWTLKQI
MEGGAMGVQITISGKLRGDRSAFEKHTQGILPRAGHHAEIVVDEDIAHVQTAMGLIGIRI
RIARKERLIPEFEMRTEKSRKEREAAAGKIKVEEIEVEGAKIEVIKVKGKADKAKSESER
IALEAKKMEELETLEEEEGQMK
Download sequence
Identical sequences K0B912
gi|407464758|ref|YP_006775640.1| WP_014965069.1.40567 WP_014965069.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]