SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465245|ref|YP_006776127.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465245|ref|YP_006776127.1|
Domain Number 1 Region: 104-271
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 4.71e-46
Family NadC C-terminal domain-like 0.0000303
Further Details:      
 
Domain Number 2 Region: 5-103
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.83e-27
Family NadC N-terminal domain-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465245|ref|YP_006776127.1|
Sequence length 271
Comment nicotinate-nucleotide pyrophosphorylase [Candidatus Nitrosopumilus sp. AR2]
Sequence
MAFNSKKQLSQFLSEDIGKGDITSNLLPKKKISAKIISRENAIVAGTTYAKEIFRLKGCN
ARILKKDGSKIKPNQTIMIITGNAGNILTCERTALNLLTRMSGIATQTDALVKKIPKKTK
LYATRKTAPGLRYFDKEAVEIGGGKKHRLRLDEMVMIKDNHIVIENSLLSLIKKAKKKHK
KFEVEVENTSDAVLAASEGASIIMLDNFTPKQIKKTIQVLKNQKLRNKVMLEASGGINSK
NISSYGQTGVDIISVGSITNSVKGIDMSLEI
Download sequence
Identical sequences K0BDP9
WP_014965555.1.40567 WP_014965555.1.82955 gi|407465245|ref|YP_006776127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]