SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465273|ref|YP_006776155.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465273|ref|YP_006776155.1|
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 0.0000000000000288
Family Ribosomal protein L39e 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407465273|ref|YP_006776155.1|
Sequence length 52
Comment 50S ribosomal protein L39e [Candidatus Nitrosopumilus sp. AR2]
Sequence
MAARKSSPRKIRLLKKTKQTSAVPAWIILKTKRSVRTNPKRRAWRSTDVEVG
Download sequence
Identical sequences K0BAG1
WP_014965583.1.40567 WP_014965583.1.82955 gi|407465273|ref|YP_006776155.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]