SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465296|ref|YP_006776178.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465296|ref|YP_006776178.1|
Domain Number 1 Region: 93-223
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 2.78e-40
Family CTP-dependent riboflavin kinase-like 0.00012
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000856
Family MarR-like transcriptional regulators 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465296|ref|YP_006776178.1|
Sequence length 227
Comment hypothetical protein NSED_07210 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MTELKIQHILTLSYLLSKGAKYNYVSITTSSLGKNIKKSQQSASKHLLELEQNQFIERII
NGRNISVKITPKGYSEMVKLSATLQKSLDSSPSHVELKGTLVSGMGEGAYYMGLKGYTKQ
FESKIGYVPYPGTLNVKLDQKIHQEAIKQFETLEGVKINSFSDGKRTYGWVKCFAAKLNN
SANCELIILERTHHDDSIIELISKTCLRKIAKLKDGSKVSIKIPINS
Download sequence
Identical sequences K0BFY4
WP_014965606.1.40567 WP_014965606.1.82955 gi|407465296|ref|YP_006776178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]