SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465313|ref|YP_006776195.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465313|ref|YP_006776195.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily GlnB-like 3.15e-24
Family Prokaryotic signal transducing protein 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407465313|ref|YP_006776195.1|
Sequence length 104
Comment nitrogen regulatory protein P-II [Candidatus Nitrosopumilus sp. AR2]
Sequence
MKKIEAIVPAGTKDAVITAIKKVGVGGVTVHQVQGQGAQDPPLVGQYFSRDMIICVVDDP
KLDEVIDAIANVACTGTKGDGKVFVTEIVDALDICTKKRGTMDI
Download sequence
Identical sequences K0BAM5
gi|407465313|ref|YP_006776195.1| WP_014965623.1.40567 WP_014965623.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]