SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465346|ref|YP_006776228.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465346|ref|YP_006776228.1|
Domain Number 1 Region: 69-203
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.0000000000654
Family Band 7/SPFH domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465346|ref|YP_006776228.1|
Sequence length 287
Comment hypothetical protein NSED_07460 [Candidatus Nitrosopumilus sp. AR2]
Sequence
MSKYQSPKVNVNMSAAKGVAVAIVLLIIIGVVATASVKIVDSGHRGVLLHWSAVDLTQPP
LDEGLHFVVPFQDEVVNIEVRTLKYASDARSASRDLQTVETTVTVNYHPDKEAVHRLYKN
LGLDYENRVIQPAIEETVKQVTAKYNAEELITKRPLVKQDIEAAITERLNQFEVITDVIS
ITDFEFSPLFAQAIESKVEAEQNALRAENDLRRIEVEARQTEANAVGLANANIAEAKGEA
EAIAIINRALAENPNYLDWLKTQAWDGKLPLVVGEGGTPFIQIPVKP
Download sequence
Identical sequences K0BG53
gi|407465346|ref|YP_006776228.1| WP_014965656.1.40567 WP_014965656.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]