SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465371|ref|YP_006776253.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465371|ref|YP_006776253.1|
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 6.08e-88
Family Purine and uridine phosphorylases 0.0000000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465371|ref|YP_006776253.1|
Sequence length 263
Comment methylthioadenosine phosphorylase [Candidatus Nitrosopumilus sp. AR2]
Sequence
MEKDVEIGIFGGTGIYDSGLLENAQEVDVNTPYGKPSDTITVGTFKGRKIAFLPRHGKKH
TIPPHKINFKANIWAFKELGVTRIIAPSAVGSLKEELEPGHFALPTQFLDFTKSRDGSFS
EDGRVIHISVADPFCPELQSSILQVTDNQDMDMHKDCTYVCIEGPRFSTKAESKFYRTTG
ADIIGMTLVPECQLAREAQMCYASISTVTDYDVWAEKPVTAKEVLETLSKNVEKTKKVLT
ELIDKIPKTRSCSCAKALEEAEF
Download sequence
Identical sequences K0BG95
gi|407465371|ref|YP_006776253.1| WP_014965681.1.40567 WP_014965681.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]