SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465639|ref|YP_006776521.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465639|ref|YP_006776521.1|
Domain Number 1 Region: 629-872
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 9.15e-38
Family SGL-like 0.0064
Further Details:      
 
Domain Number 2 Region: 21-118
Classification Level Classification E-value
Superfamily E set domains 0.0000000000189
Family Copper resistance protein C (CopC, PcoC) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465639|ref|YP_006776521.1|
Sequence length 927
Comment copper resistance D domain-containing protein [Candidatus Nitrosopumilus sp. AR2]
Sequence
MKKLLIFLVILSSISLPFVYAHPFTEQTIPSLETNSPTGTTKVIVFFSEPVDINFSELKV
LDNNGNQIDNKDTDYYEGEQSLIVTTPPLEDGVYTATTKVLSKVDGHLVPGAFLFAVGDV
IVDPSILGIERPSEIVFLPEAGARFPGIVGQTIVLGVVIASLFIWGTQNKKIIKEELEKI
ENIHHGKFMSLTGIGLGLVFVSNILMIAVQSIRLEASPLDAIQTDFGMTWILRMIITVIL
LGIWFGLDRSKSLSNKNQIPMLVAMLALISTSSLIGHGAASGEMPALVLDYIHNLVSGIW
IGGMIYFVFTLLPTFSQLKEPKREMMSLLMIPRFSIAFIIAVGIVIITGPTLMWFLESDV
GLITESVYGQLIILKIAIAAVMVLLGGFFQFKVQKNAEKNFSSGKISVHKKLKRSLKVDA
VLGIILLGVVALLTNGTLPAGEIQKVDAQEVVYGFKTIEFTENAKFDIDISPFSSGTNTI
LVQVSDFEGNQLSDLDEVKVKVSNPSRNIAPIEVPMQIMKQGEDNVSEFQGELTFGFSGE
WLVEIDAQRTENANESKLMNLLVKPKLANIQTQITEYELPEDAKPLFPVYDGNNSIWLSD
ASSPKLWQFSLDTLEFSSYSFDGLTTTFLTQDNKGNIWFTDTPANQIGFIDPDTKQITTK
TIPKLDPVISKNTPLFIKSDFDGNIWITIVNKDRIVKYLPEEDEFEEIVLSGKENLPFAL
AFDDNGRMWYTSTGSGKIGYIDPDDNDITEISTDTVLQGPEALLFDKDGNLWIAEHTGLA
ITKFNPVLETFERISVPDEEALPFGMTFDKYGNVWFAQHTIDSLGVYDPDNNNLIEVPIP
TETSFVQFMTSDGNDNVWFVEQQSNKIGMVKLTEIPVIPSQIESLNEIKIKYAELASPLI
ALGIIATSLFYVKSIQDKRRLNSLINS
Download sequence
Identical sequences K0BDM9
WP_014965945.1.40567 WP_014965945.1.82955 gi|407465639|ref|YP_006776521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]