SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465709|ref|YP_006776591.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465709|ref|YP_006776591.1|
Domain Number 1 Region: 10-118
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 5.79e-24
Family Type II deoxyuridine triphosphatase 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407465709|ref|YP_006776591.1|
Sequence length 118
Comment dUTPase [Candidatus Nitrosopumilus sp. AR2]
Sequence
MSLSQETSEKDRLETIFKLQKGLSEMMKLDRYPKDSEGRISALCTAIMHEAVELQRTTNW
KWWKTPIEFNEDEAREELIDIWHFVVQASLELKLTPDDILKEYKKKNEINRERQRNGY
Download sequence
Identical sequences K0BDV4
WP_014966014.1.40567 WP_014966014.1.82955 gi|407465709|ref|YP_006776591.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]