SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407465740|ref|YP_006776622.1| from Candidatus Nitrosopumilus sp. AR2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407465740|ref|YP_006776622.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily GlnB-like 0.0000000000000413
Family Prokaryotic signal transducing protein 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407465740|ref|YP_006776622.1|
Sequence length 197
Comment nitrogen regulatory protein P-II [Candidatus Nitrosopumilus sp. AR2]
Sequence
MKKIEAIIKRKHFPTIKTTLNTIGTYIIDKRNLDDSNIYDESQGSRAGSTGLKSVPLAKL
EMVVSDKDARKVVEMISKNSGLSSNHGGKIFVSEMEEVVDMETLDGRKDLEIITEIKPDT
ELESKPLPKRSRFVPLQKFTLHKLQATYEKNKETLRDDYRIKSFSDFVNYCIMKSLPTLE
KQLKNPTIIYENNFDDF
Download sequence
Identical sequences K0BF47
gi|407465740|ref|YP_006776622.1| WP_014966044.1.40567 WP_014966044.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]