SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343127420|ref|YP_004777351.1| from Borrelia bissettii DN127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343127420|ref|YP_004777351.1|
Domain Number 1 Region: 303-514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.82e-38
Family ABC transporter ATPase domain-like 0.00046
Further Details:      
 
Domain Number 2 Region: 86-289
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00000000262
Family DNA repair protein MutS, domain III 0.031
Further Details:      
 
Domain Number 3 Region: 704-779
Classification Level Classification E-value
Superfamily SMR domain-like 0.000000183
Family Smr domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|343127420|ref|YP_004777351.1|
Sequence length 780
Comment mutS2 family protein [Borrelia bissettii DN127]
Sequence
MQDKQDKYLKNIDFYEILSLVSKYVSNPDTVDLLRNQKILKTRESLEKMFSFVSLIRMLF
ESYKGYPNSFINGLKYLISLLSKENSRVSIENLKDIVVFLDEILRINLFLHKNSDIKHLN
VQILSDLLFLNPELKNLLNELKEHIDVDSLELKSGVVKEYDSIEFEIKNLNRRVENQIKR
IISLNAEYLTSNFVYYKSNKYTLALKSNFKGKIKGNIISISSSGETFYIEPNDILNDNNR
LNYLSLEKERIILKILQNLSAKVHNDIVLLNNLYNNFLYYDSLKARAIYGIKTKGIFPEI
SNILNIFDAHHPLLKDPKAITFTPSENRVVIITGPNAGGKTVTLKTIGLLSAMFQFGIPI
TVGESSTFKIFDNIFIDIGDEQSISNSLSTFSSHMSNISYILKHTTKNSLVIFDEFCSGT
DIDQGQALAISILEYLININPYVLISTHYNALKYFAYTHKGVINASMRMDLETMQPNYNL
IFSIPGESYAFNVASRALIDRSIVVRANEIYSSQKTEINEILEKLIEKEKDLLLIKENMN
KKLIQIELREKEIENFHQDLLLKEKNIETELLNEQNEFLKNSRKVLENLVREIKEGNINV
AKNKAFISDLKKNVDLKLNKVNSLNNKRNMAANFKIGDRVKILNSNAKGKIVEISKKKIT
VNVGAFNVSVSSSEISLENFKEKKEDGKNFNFSIDYDKENLLSLTVDIRGMRAVDALDFL
NKKIDNIILNGINKFEIIHGKGEGHLMREVHNLLKELKFVRKYYFAHPSDGGSGKTIVEI
Download sequence
Identical sequences G0AKR0
gi|343127420|ref|YP_004777351.1| WP_014023355.1.90944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]