SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343127869|ref|YP_004777800.1| from Borrelia bissettii DN127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343127869|ref|YP_004777800.1|
Domain Number 1 Region: 198-383
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.84e-67
Family Methylesterase CheB, C-terminal domain 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|343127869|ref|YP_004777800.1|
Sequence length 385
Comment cheB methylesterase family protein [Borrelia bissettii DN127]
Sequence
MKILVIDIQGLIKQVFVRAFSKDNDVEILNAGFNSLNLINVFLQKFPDLVIIDENTARSN
FGNSLNNVLNKISLPVVFIAQNEMFPNFGCLEQSKEKIRLIINKLNFKLTVDLFRSKYLA
LIKLELKNLGKNKLISSFEVKRIHAPDFSSNSKVELKENSLDDSSIRKSYKVSDVINFAP
KNDPDVIIKYQGLINKHKTGKIIVVGSSTGGTEALRIFLRSFKKDSPPIIIVQHMPGGFT
KSFAKNLNNEFNIDIKEAEDGDILRPGLVIIANGSYHLIVKYSSGNYFVNLLDGPLVSRH
KPSVNVLFRSAAMYAGSNAIGVILTGMGDDGAVCMLEMKKNGAYTIAQDQETSVVFGMPM
EAIKIGAVDKILPLSEIADHVLRRS
Download sequence
Identical sequences G0AM09
gi|343127869|ref|YP_004777800.1| WP_014023784.1.90944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]