SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|343128094|ref|YP_004778025.1| from Borrelia bissettii DN127

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|343128094|ref|YP_004778025.1|
Domain Number 1 Region: 264-556
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 8.76e-63
Family DNA repair protein MutS, domain III 0.0000798
Further Details:      
 
Domain Number 2 Region: 559-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.73e-50
Family ABC transporter ATPase domain-like 0.0000028
Further Details:      
 
Domain Number 3 Region: 4-106
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.28e-35
Family DNA repair protein MutS, domain I 0.0000351
Further Details:      
 
Domain Number 4 Region: 106-263
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.96e-28
Family DNA repair protein MutS, domain II 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|343128094|ref|YP_004778025.1|
Sequence length 863
Comment DNA mismatch repair protein MutS [Borrelia bissettii DN127]
Sequence
MEKNVTPMMRQYLNIKKQHKDAILFFRVGSFYEMFFDDAIEASKLLNLTLTKRENVPMCG
VPYHTSKEYIRKLILFDKKVAICEQASNSTSGGPLEREVVEVITPGVIIDEDFLNDDVNN
YLVAISDYKNYYSFSYIDLSTSSLGIMFYENSFFEKLKRDLEKYSPKEIIVSENFYYEYS
DKLNLSRFLINKVPAWHLDKDIAIKTIKEHFNILGLSSLGFDEEKPYYISIFLIINHIKN
NLKNLLSNIDKIDINNDSSYMFLDDVTQVNLELVKNNNDFSSQYSLYSVLNDCKTAMGKR
LLREFILNPILNISEINTRLDHVEFFCKNIGLTMTLRETFIDIWDIERIISRIQMKRYIK
KDFLFIEKALSVFFRVKKLFNKYNFDYWNFNKFEEDSISKVCFLINSAISNLPDELIKRG
YDLKLDSLKDLKINANKYIDKYLESERLLSKINNLKIRKTNNRGLFFEVTKSNYAQVPPH
FMESQTLNSSKRYKTEKLISLEVDINNAEDNVVAFEQEIFDEIASNVVKHNKVLKKVAEF
FAYIDLVVNFGYLAKKNEYKRPVLTSDKEIFLDKSRHPVVEYYVKNTEIFTENFVRIDKE
RYFCLITGPNMAGKSTYLRQVALITLMAHIGSFVPASKAVIGVTDKIFCRIGASDNIAKG
ESTFLVEMNETANILRNATEKSLIIMDEVGRGTSTNDGLAIAYSIIEHILEYIKARSLFA
THFHELSSINHKAFINLSMKIEKQGSDLVFLREVEEKPSLNSYGIYVARIAGLPLRVIDR
ANVILESLLDRKGNSFLELLPAVSSDSNDGGKDLKNDTNVHIKLNEYLELKNFISNIDIN
NITPFQSIELLNQIVLKVVSQSS
Download sequence
Identical sequences G0AMN4
WP_014024004.1.90944 gi|343128094|ref|YP_004778025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]