SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429190589|ref|YP_007176267.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429190589|ref|YP_007176267.1|
Domain Number 1 Region: 464-904
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.84e-105
Family DNA polymerase I 0.0000122
Further Details:      
 
Domain Number 2 Region: 77-462
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5e-64
Family DnaQ-like 3'-5' exonuclease 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429190589|ref|YP_007176267.1|
Sequence length 909
Comment DNA polymerase elongation subunit [Natronobacterium gregoryi SP2]
Sequence
MTEAGQAGLTEFSSSPESDGEKRPDEEAVAVAGATNGSGVEVVDVVEETLPDADGDLELA
VMQVDYTVTGYGDEEQPIIHVFGRTPDGTLEHVQVVDFEPYFYAPTETLERPPEEEYDRL
TGSREYDRNGERYESIRGEKLTKIFGQTPRDVGQVRDDFEHYEADILFPNRFLIDKDVRS
GIRIPERRADDDSLVIHHEEVEPVDVDAEPRVLTFDIEVDDRSGFPEDGEEPIVCLTSHD
SYEDEYIMWLYEAPIGDGEIPAEIAEYDPIEGEIDHEVRAFEEEEAMLEAFMEYVEETDG
DVLTGWNFEDFDAPYFLDRLEELQGGHDYDLSIDRLSRVDEVWRSNWGGPDIKGRVVFDL
LYGYQRMVFSELDSYRLDAVGEEELGVGKERYAGDIGDLWEDNPTQLLEYNLRDVELCVE
LDRQQAIVAFWDEVRSFVGCKLEDAPTPGDAVDMYVLHQAHGRFALPSKGQQEAGEEYEG
GAVFEPITGVKENVTVLDLKSLYPMCMVTVNASPETKVDPETYDGETYEAPTGTHFRKEP
DGVNRTMIEELLAEREEKKELRNQHEPGTPEYEQYDRQQGAVKVIMNSLYGVSGWEQFRL
YDKEAAAAITATGREVIEFTETAANELDYQVAYGDTDSVMLELGDGIPKEKALETSFEIE
EHINDRYDDFAREDLNADQHRFQIEFEKLYRRFFQAGKKKRYAGHITWKEGKDVDTIDIV
GFEYQRSDIAPITKEVQHRVIEMIVKEGDVEGAKEYVNGVIEDVLDGNVSDEEIAIPGGI
GKRLDNYDTDTAQVRGAKYANLLLDTNFQRGSKPKRLYLDRVDPAFFRRMEDECGFDPQR
DPLYGAFKRDPDVICFEYDDQIPEAFEVDYDKMLEKTLKGPIERILEALDVSWEEVKSGQ
EQTGLDSFM
Download sequence
Identical sequences A0A1I3LR12 L0AD40
gi|429190589|ref|YP_007176267.1| WP_005576206.1.6326 WP_005576206.1.71579 WP_005576206.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]