SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429191022|ref|YP_007176700.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429191022|ref|YP_007176700.1|
Domain Number 1 Region: 3-211
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.8e-45
Family Ribonuclease H 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429191022|ref|YP_007176700.1|
Sequence length 221
Comment ribonuclease H, mammalian HI/archaeal HII subfamily [Natronobacterium gregoryi SP2]
Sequence
MPFGVDEAGKGPVLGSMFAAAVYVPEAAALPDGIADSKRLAPEHREKLAATLREDDRFGI
GVAEISTGRIDEPTTDMNSLTVEAHANAIEAALEDCALENDSVDGLCDACDTDANRFARR
VADAASLSRDLDLEARHGADDDSPVVGAASIVAKVERDAHVAAISEEYGDVGSGYPSDPT
TREFLESYVDDHGELPPFARSSWSTCEKALASAQQTGLEQF
Download sequence
Identical sequences A0A1I3Q5I9 L0AEJ8
WP_005581658.1.6326 WP_005581658.1.71579 WP_005581658.1.8181 gi|429191022|ref|YP_007176700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]