SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429191261|ref|YP_007176939.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429191261|ref|YP_007176939.1|
Domain Number 1 Region: 88-203
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.0000000000000375
Family Tetracyclin repressor-like, C-terminal domain 0.0048
Further Details:      
 
Domain Number 2 Region: 17-85
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000616
Family Tetracyclin repressor-like, N-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429191261|ref|YP_007176939.1|
Sequence length 207
Comment transcriptional regulator [Natronobacterium gregoryi SP2]
Sequence
MADTPGAGWVSTSTDEFDETTEEIMRAVYRALSKNGYPETTMAEIASEFEKSKGLLYYHY
DSKEAILNDFFTYLCQRLQSSLIEESYEDPYERLLAVVDRILPAAIDDEQLEFRQALFEV
RSQAPHNRSYYEQIRRSDRIILETLTETIQQGVETGRFADVDPERRAELLFSTLYGIMER
GAALGDRDLVERNREMVRVRLERTLLA
Download sequence
Identical sequences A0A1I3KY07 L0AHE3
gi|429191261|ref|YP_007176939.1| WP_005575450.1.6326 WP_005575450.1.71579 WP_005575450.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]