SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|429191705|ref|YP_007177383.1| from Natronobacterium gregoryi SP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|429191705|ref|YP_007177383.1|
Domain Number 1 Region: 13-244
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-56
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0000367
Further Details:      
 
Domain Number 2 Region: 333-494,749-805
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.91e-38
Family Intein (protein splicing domain) 0.025
Further Details:      
 
Domain Number 3 Region: 287-356,808-1094
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.7e-27
Family Extended AAA-ATPase domain 0.013
Further Details:      
 
Domain Number 4 Region: 571-668
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000000623
Family Intein endonuclease 0.067
Further Details:      
 
Domain Number 5 Region: 683-730
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000652
Family PrgX N-terminal domain-like 0.067
Further Details:      
 
Weak hits

Sequence:  gi|429191705|ref|YP_007177383.1|
Domain Number - Region: 481-556
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000198
Family Intein endonuclease 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|429191705|ref|YP_007177383.1|
Sequence length 1172
Comment ATPase [Natronobacterium gregoryi SP2]
Sequence
MAQAGTSELVDSFEQFFRNYYDNEIKQLAQQYPNEKRSLYVDWQDLYRFDPDLADDFLSQ
PEQLQRYAEEALRLYDLPIDVSLGQAHVRIRNLPKTESPEIREIRSRDMNSLVEVRGIVR
KATDVRPKIEEAAFECQLCGTLTRVPQSSGDFQEPHECQGCERQGPFQVNFDQSEFVDSQ
KLRIQESPEGLRGGETPQSLDIHVEDDITGEVTPGDHVSAAGVLRLEQQGDGQDKSPVFD
FYMEGMSVDIEEEQFEDMDITDEDKKQIYEISNGDDVYERMVGSIAPSIYGYEQEKLAMV
LQLFSGVTKQLPDGSRIRGDLHMLLIGDPGTGKCVKGDTKITLADGRTAPIHQLVESNLE
DPKPIDDGWWDEIDLEVPSLQDDGSIAPQRATKVWKREAPEQMCRVRTSSGRELEVTPSH
PLFVQQDGQFTPIVADDLTEGQFVAAPKNYPTDGDDVLDIDFRRSKSRNAVQLDLPTEWT
PSLARLIGYVIVEGYVEQRDDNTGFVSITTNDRAVLNDATNALEELGLNTTERDAHEGKE
ARELRCSAGELVSFLEALEPYILQSSDEQCVPDDLFKASDPIRSEFLKAFIEGEGHVSAS
QREITVASMSRGLLEDIRTLLLSVEIRSQLHERRNGSYRLRISASEFEKYVAKIGFVTPR
KQKSAERYADTKGNTNLDIVPGVGSELRQIRESLSLTQAECGLPRSTYQHYEQRSRNPSR
ESLREVIGAFKDALPREKSQAEAGALADGGSVRASIAALEQFVEGDVYWERIESIETVEP
DYNWVYDLEIDGTHSYVSNGIVSHNSQMIGYIQNIAPRSVYTSGKGSSSAGLTAAAVRDD
FGDGQQWTLEAGALVLADQGIAAVDELDKMRSEDRSAMHEALEQQKISVSKAGINATLKS
RCSLLGAANPKYGRFDQYEPIGEQIDLEPALISRFDLIFTVTDQPDEEKDKNLAEHILTT
NYAGELTTQQEQMTSLEVDQDEIEQMTEQVDPEIDAELLRKYIAFAKQNCHPRMTDEAQE
TIRDFYVDLRARGTDEDAAVPVTARKLEALVRLAEASARVRLSDTVEQHDAEQSVEIVRS
CLQDIGVDPETGEFDADIVEAGTSKSQRDRIKNLKQLIGDIEEEYDEGAPVDIVLDRAEE
IGMDQSKAEHEIDKLKQKGEVYEPSTDNLRTT
Download sequence
Identical sequences A0A1I3K5T0 L0AHL1
gi|429191705|ref|YP_007177383.1| WP_005578335.1.6326 WP_005578335.1.71579 WP_005578335.1.8181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]